A New Life: Pregnancy， Birth， and Your Child's First Year : A Comprehensive Guide pdf epub mobi txt 电子书 下载 2026

Fg~~~~ Th~ .，omL~ta of c，，ncepuon<br > A sperm ranged) pf~netr~tes the wail<br > of an ovum The actual diameter<br > of a human ovum read)， for forglization<br > is approximately ~，~， in (0，12ram)<br > CHAPTER I<br > The female reproductive organs Scientific knowledge about human reproduction is father and half of which come from the mother， that caution than was at first the case Male anti female<br > expanding rapidly， and in the last several decades it carry the genes. The important and rapidly develop- sterilization have also become more widespread m<br > The menstrualcycle has become more and more feasible to control the mg new science of cytogenetics is concerned with recent years largely because of the problems which<br > process， making it more than ever possible for thesematters and is highly relevant to childbearing， ariseifthemodernmethodsofcontracept onare used<br >The male reproductive organs/Fertilization parents to understand what is involved. This chapter Some of the ways in which chromosomes act are now over a long period of time. But sterilization must be<br > describes the male and female reproductive organs understood. For example， it is known that many approached asan irreversible procedure， and there [s<br > Genetics and inheritance and their functions， and explains how fertilization abnormalities are determined by minor changes in still a long way to go before the kleal contracepuve<br > takesplaceandthewayinwhichtheferti zedeggis the chromosomes， resulting in defects in single method is perfected.<br > Infertility implanted in the uterus. It also looks at the woman s enzymes within the cells. This new knowledge One result of widely practiced contraceptmn and<br > menstrual cycle and the ways in which moderJl enables couples to be given a more realistic picture of abort on is an acute shortage of babies for couples to<br > contraception works as well as the prob ems of therisksofconceivingchildrenwithvariousparticu- adopt Th s in turn accentuates the plight ofeoupies<br > infertility and the process of inheritance， lar genetic defects， who are infertile. Fortunately great progress has a so<br > Although thebaaie anatomy of the male and female At the same time as developments in genetics have been made in the treatment of infertility in the last<br > reproductive organs has been known for hundreds of enabled couples to make more rational decisions ten years. Methods of inducing ovulation when ~t<br > years， the moat dramatic advances in the science of about whether to have children， contraception has fails to occur naturally are improving all the time<br > physiology (the study of the functions of living made it possible to choose when to have them. andtheab 1 tytomeasurehormonelevelshasmadeit<br > Contraception of one sort or another has of cou ， possible to diagnose the problem more accurately<br > things)the firsthavefiftybeenyears，madethedUringhormones，this centurY.or cbemic~dDuring been practiced throughout history. Coitus inter- There are still， however， many women vith， mmged<br > messengers， which play such a central part in repro ruptus has always been used the ancient Egyptians fallopian tubes which are difficult to treat. I oday，<br > duction， were discovered. Hormones act on enzyme~ apparently used a vaginal paste made of crocodile there s great progress in overcoming this probhqa b~<br > - the molecules in every human cell that govern the ~Ung and honey and barr er methods of contracep- repa r ng the damaged tubes or by-passing the prof .<br > chemicalreactionsofthebody andtheseinturna e ~nbavebeenemployedforover400years. Butthese lem by in vitro fertilization and embryo transfer<br > determined by the genes thai an individual inherits<br > methods were efficient and were frequently Newer procedures such as GIFT and its varlatlt， ns<br > from his parents. " "<br > ~clally unacce )table， For examp e. as -ecen y as are also helping to overcome problems. Male ini ert~-<br > The underlying principles of inheritance hav~ t 77. Enghsb authors who described contraceptive ty is receiving more serious consideration and the<br > been understood for only a hu adred years， lu rece ~ e~hmq.ues were sent to prison， number of clinics for tiffs problem are incl easmg<br > years scientists have discovered the mechanisms .he first half of this century saw contraception A th s iodern scientific knowledge， and the"<br > cto~r~z，ne.~ which transfer inherited characteristics from ben goammg soc al acceptallce and ill tile 195fis efficient acreased ability to plan should not obscure the fact<br > S~at*o CbJ~t.r<br > ~ eration to generation via the man s sperm and t]w Sral contracept yes were produced for the first time. mt reproduction remains a natural process and<br > ~ hortly thereafter， intrauterine devices were re- sexuality is instinctive. Knowledge of what is ilL-<br > --- _ =~ woman s ova. The ist of charaeterlst cs the ca/~ it <br > d~e~/~i---- -- ~ identified as genetically determined continues * ~troduced in a modern form. These wo methods volvedshouldneverinterferewiththespontaneitvof<br > a grow as research into the subject continues save ，ecome veyy I op lar， d tile eomp cat ons ovemak ng. Indeed， anxiety can be an important<br > 274 In 1956 it was c early estab ished that evtq) IletL[nes assocmted with them are now being fully factor: with some infertile couples， a pregmmev s<br > 1 b II contains 46 el l 1~ ~[lll~r~I As "esul " b lly only achieved when th I t<br > these chromosomes， half of wlfich come fl-om th， I [ tq[ mid they have COlne to be treated with more consciously trying to have a child，"<br > -- H<br >